General Information

  • ID:  hor005236
  • Uniprot ID:  P0DKY6
  • Protein name:  Natriuretic peptide NP2
  • Gene name:  NA
  • Organism:  Crotalus durissus cascavella (Northeastern Brazilian rattlesnake)
  • Family:  natriuretic peptide family
  • Source:  Animal
  • Expression:  Expressed by the venom gland.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Crotalus durissus (species), Crotalus (genus), Crotalinae (subfamily), Viperidae (family), Colubroidea (superfamily), Serpentes (infraorder), Toxicofera, Episquamata, Unidentata, Bifurcata, Squamata (order), Lepidosauria (class), Sauria, Sauropsida, Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0090729 toxin activity
  • GO BP:  GO:0007165 signal transduction; GO:0008217 regulation of blood pressure; GO:0035821 modulation of process of another organism; GO:0042311 vasodilation; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  VSTSRGSQGCFGLKLDRIGAASGLGCWRRIVDS
  • Length:  33(1-33)
  • Propeptide:  VSTSRGSQGCFGLKLDRIGAASGLGCWRRIVDS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  It shows an increase in perfusion pressure, urinary flow and glomerular filtration rate;Reduces total and proximal tubular transport of sodium and causes a relaxant effect in endothelium-intact thoracic aortic rings precontracted
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  45956
  • Structure ID:  AF-P0DKY6-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P0DKY6-F1.pdbhor005236_AF2.pdbhor005236_ESM.pdb

Physical Information

Mass: 402491 Formula: C146H242N48O45S2
Absent amino acids: EHMNPY Common amino acids: G
pI: 9.9 Basic residues: 5
Polar residues: 14 Hydrophobic residues: 11
Hydrophobicity: -0.61 Boman Index: -5797
Half-Life: 100 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 82.73
Instability Index: 3203.64 Extinction Coefficient cystines: 5625
Absorbance 280nm: 175.78

Literature

  • PubMed ID:  18835291
  • Title:  Renal and vascular effects of the natriuretic peptide isolated from Crotalus durissus cascavella venom.